PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000448.1_g00012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 269aa    MW: 30582.7 Da    PI: 6.1441
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000448.1_g00012.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM121.76.7e-3851352127
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvka.eekewyfFskrdkkyatgkrknratksgy 82 
                              p+GfrF+Pt+eelv++yLk+k++g++ +++ vi+ v+iy++ Pw+Lp+    ++++ + +e++fF+  +++ ++g +++r t +gy
  Itr_sc000448.1_g00012.1   5 PQGFRFSPTEEELVCFYLKHKLQGDREDIDAVIPVVNIYDHCPWNLPQlvgeRCRGdDLEELFFFVDMQENISRGGKPKRLTPQGY 90 
                              89***************************999***************745553333234488************************ PP

                      NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                              Wka g    ++s+++e +g k+t++fy+grap+g kt+W m ey+
  Itr_sc000448.1_g00012.1  91 WKAAGIPALMYSNNNEIIGGKRTMIFYRGRAPTGIKTEWKMIEYK 135
                              ********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.15E-373146IPR003441NAC domain
PROSITE profilePS5100538.4294190IPR003441NAC domain
PfamPF023651.5E-175135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MEDYPQGFRF SPTEEELVCF YLKHKLQGDR EDIDAVIPVV NIYDHCPWNL PQLVGERCRG  60
DDLEELFFFV DMQENISRGG KPKRLTPQGY WKAAGIPALM YSNNNEIIGG KRTMIFYRGR  120
APTGIKTEWK MIEYKAILGQ PPRTATMSDV QGDCWLWPVK GQVQQVSREA KFSTQKYGGH  180
EFSLCRIYKK ARFDRGFDRR PSAPAAIFAV PRAPEPPSPH LQTVPEAIAA QASSSNPQAV  240
PESTEDPSSS QNNFWDVCVP LWDWADMGF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-20313514139Stress-induced transcription factor NAC1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24942357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44350.26e-53NAC domain containing protein 61